PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792508.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 465aa    MW: 53115.9 Da    PI: 6.384
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792508.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS295.31.5e-90854611373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++ Ll  A+av+++++  a + L +l +++s  gd++qR+aayf+ +L arl+   s  y+ +   +t+    +ee+ a++ f++vsP+++f+h
  XP_009792508.1  85 LIHSLLISATAVDENSFDSAVENLHELYQNVSLLGDSVQRVAAYFADGLIARLLTRNSPFYDMIMKLPTQ----EEEFLAFTEFYKVSPFYQFAH 175
                     57999999***********************************************9*****999888886....78889999************* PP

            GRAS  96 ltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlv 182
                     +t NqaIlea+e+e       +H+iDfdis+G+QWp+L+q+L++ ++ p   sl+iTg g+      +el+et+ rL +fA+ + +++fef+ + 
  XP_009792508.1 176 FTSNQAILEAFEKEektnnGLLHVIDFDISYGFQWPSLIQSLSENAATPNriSLKITGYGK----TIDELRETETRLVSFAKGFrNLSFEFQGV- 265
                     *************955544456*********************9996665579********....99***************9758*******7. PP

            GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                        l+  +l++L  +++E+la+nl+++l +l   s s     +++Lk v +l P +v++veqe   + ++Fl rf+e+l+y++a+fdsl+  lp 
  XP_009792508.1 266 ---LSGSKLSNLIKRKNETLAINLIFHLNSLS--SYSK---VSHTLKEVHNLCPSIVTIVEQEGCKSPQNFLPRFMESLHYFAAMFDSLDDCLPI 352
                     ...77888999*9999***********99997..4444...458*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrve...........eesgslv 359
                     +s er ++E+ llg+ei+nv+  e+++    r e++e+W+ r+e+ GF  +pls+k+ +qaklll+  + s   +++           e+  ++ 
  XP_009792508.1 353 DSIERLSIEKNLLGKEIKNVLNYEKNNnFLSRYEQMETWKGRMESHGFLGLPLSSKNIMQAKLLLKIRShSSPIQLDggnggfmifetEDPRAIS 447
                     ************************9993469**********************************977644434444444444444544455555 PP

            GRAS 360 lgWkdrpLvsvSaW 373
                     l W+d ++v++SaW
  XP_009792508.1 448 LAWQDWSIVTASAW 461
                     ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.25259430IPR005202Transcription factor GRAS
PfamPF035145.3E-8885461IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGDIVDQEEE LLCLRLAIVT NSCCERKKIK KRKRKELAFI NTWDLNESNY CEGKIFRLLE  60
LRESMLKIDV KKKASVVEDG KGLHLIHSLL ISATAVDENS FDSAVENLHE LYQNVSLLGD  120
SVQRVAAYFA DGLIARLLTR NSPFYDMIMK LPTQEEEFLA FTEFYKVSPF YQFAHFTSNQ  180
AILEAFEKEE KTNNGLLHVI DFDISYGFQW PSLIQSLSEN AATPNRISLK ITGYGKTIDE  240
LRETETRLVS FAKGFRNLSF EFQGVLSGSK LSNLIKRKNE TLAINLIFHL NSLSSYSKVS  300
HTLKEVHNLC PSIVTIVEQE GCKSPQNFLP RFMESLHYFA AMFDSLDDCL PIDSIERLSI  360
EKNLLGKEIK NVLNYEKNNN FLSRYEQMET WKGRMESHGF LGLPLSSKNI MQAKLLLKIR  420
SHSSPIQLDG GNGGFMIFET EDPRAISLAW QDWSIVTASA WHCVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-38854624375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12634KKIKKRKRK
22934KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792508.10.0PREDICTED: scarecrow-like protein 21
TrEMBLK4D6L30.0K4D6L3_SOLLC; Uncharacterized protein
STRINGSolyc11g017100.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123541823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.12e-57SCARECROW-like 21